Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM266 Rabbit Polyclonal Antibody (FITC)

TMEM266 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HVRP1, HsHVRP1, C15orf27, hTMEM266

UniProt

Q2M3C6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C15orf27

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EMEMVIQQYEKAKVIQDEQLERLTQICQEQGFEIRQLRAHLAQQDLDLAA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

AAI04954

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLIC1 (NM_001288) Human Over-expression Lysate
LY400515 100 µg

CLIC1 (NM_001288) Human Over-expression Lysate

Sign In for Pricing
View Details
IL2 Receptor beta (IL2RB) Mouse Monoclonal Antibody [Clone ID: OTI1D1]
CF812259 100 µg

IL2 Receptor beta (IL2RB) Mouse Monoclonal Antibody [Clone ID: OTI1D1]

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1892), CF594 conjugate, 0.1mg/mL
BNC941892-500 1x 500 µL

CD10 (Membrane Metalloendopeptidase) (MME/1892), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CF®640R TUNEL Assay Apoptosis Detection Kit
#30074 1 Kit

CF®640R TUNEL Assay Apoptosis Detection Kit

Sign In for Pricing
View Details
Recombinant Human PPIase/FKBP7 Protein (aa 1-218, His Tag)
PKSH030674 100 µg

Recombinant Human PPIase/FKBP7 Protein (aa 1-218, His Tag)

Sign In for Pricing
View Details
Tissue FFPE Sections, Liver: left lobe
CS710688 5x 5 µm

Tissue FFPE Sections, Liver: left lobe

Sign In for Pricing
View Details