Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM266 Rabbit Polyclonal Antibody (HRP)

TMEM266 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HVRP1, HsHVRP1, C15orf27, hTMEM266

UniProt

Q2M3C6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C15orf27

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EMEMVIQQYEKAKVIQDEQLERLTQICQEQGFEIRQLRAHLAQQDLDLAA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

AAI04954

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PD-L1/CD274 Rabbit mAb
E45R12841N 50 ul

PD-L1/CD274 Rabbit mAb

Sign In for Pricing
View Details
GLI2 (GLI Family Zinc Finger 2) BioAssayTM ELISA Kit (Rat) discontinued
519260 96 Tests

GLI2 (GLI Family Zinc Finger 2) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
Recombinant Human MAPK9 Protein, N-His
orb3061700-01 50 µg

Recombinant Human MAPK9 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human MAPK9 Protein, N-His
orb3061700-02 100 µg

Recombinant Human MAPK9 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human MAPK9 Protein, N-His
orb3061700-03 1 mg

Recombinant Human MAPK9 Protein, N-His

Sign In for Pricing
View Details
Rabbit anti-Cytokeratin 18 (pS33) Antibody
MBS4506708-01 0.05 mL

Rabbit anti-Cytokeratin 18 (pS33) Antibody

Sign In for Pricing
View Details