Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPATA2L Rabbit Polyclonal Antibody (FITC)

SPATA2L Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Tamo, C16orf76

UniProt

Q8IUW3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SPATA2L

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SPPAELAYRPPLWEQSAKLWGTGGRAWEPPAEELPQASSPPYGALEEGLE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_689552

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP16 Conjugated Antibody
orb1622206 100 µL

MMP16 Conjugated Antibody

Sign In for Pricing
View Details
Frizzled-5/8 discontinued
536473-01 30ul

Frizzled-5/8 discontinued

Sign In for Pricing
View Details
Frizzled-5/8 discontinued
536473-02 100 µL

Frizzled-5/8 discontinued

Sign In for Pricing
View Details
Lentiviral mouse Lhfpl3 shRNA (UAS) - Lentiviral mouse Lhfpl3 shRNA (UAS) (100)
GTR15225630 1 Vial

Lentiviral mouse Lhfpl3 shRNA (UAS) - Lentiviral mouse Lhfpl3 shRNA (UAS) (100)

Sign In for Pricing
View Details
ZNF331, NT (ZNF331, RITA, ZNF361, ZNF463, Zinc finger protein 331, C2H2-like zinc finger protein rearranged in thyroid adenomas, Zinc finger protein 361, Zinc finger protein 463) (MaxLight 750) discontinued
044195-ML750 100 µL

ZNF331, NT (ZNF331, RITA, ZNF361, ZNF463, Zinc finger protein 331, C2H2-like zinc finger protein rearranged in thyroid adenomas, Zinc finger protein 361, Zinc finger protein 463) (MaxLight 750) discontinued

Sign In for Pricing
View Details
RPA34 Antibody
orb1325164 100 µL

RPA34 Antibody

Sign In for Pricing
View Details