Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD13B Rabbit Polyclonal Antibody (HRP)

ANKRD13B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ20418, FLJ25555

UniProt

Q86YJ7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ANKRD13B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HPMSYEGRRQDRSAPPTPQRQPAPPASVPSPRPSSGPGSGGHVFRSYDEQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_689558

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vom2r59 Protein Vector (Rat) (pPM-C-His)
PV315869 500 ng

Vom2r59 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Leptin receptor Rabbit pAb, BF700 conjugated
orb2846925 100 µL

Leptin receptor Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
RUNX1 Peptide
orb2018697 100 µg

RUNX1 Peptide

Sign In for Pricing
View Details
Disposable Trocar
WZDT-A-12/100 10x 50 PCS/CTN

Disposable Trocar

Sign In for Pricing
View Details
F13A1 (Coagulation Factor XIII A Chain, Coagulation Factor XIIIa, Protein-glutamine gamma-glutamyltransferase A Chain, Transglutaminase A Chain, F13A) (MaxLight 550)
MBS6211421-01 0.1 mL

F13A1 (Coagulation Factor XIII A Chain, Coagulation Factor XIIIa, Protein-glutamine gamma-glutamyltransferase A Chain, Transglutaminase A Chain, F13A) (MaxLight 550)

Sign In for Pricing
View Details
F13A1 (Coagulation Factor XIII A Chain, Coagulation Factor XIIIa, Protein-glutamine gamma-glutamyltransferase A Chain, Transglutaminase A Chain, F13A) (MaxLight 550)
MBS6211421-02 5x 0.1 mL

F13A1 (Coagulation Factor XIII A Chain, Coagulation Factor XIIIa, Protein-glutamine gamma-glutamyltransferase A Chain, Transglutaminase A Chain, F13A) (MaxLight 550)

Sign In for Pricing
View Details