Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT222P Rabbit Polyclonal Antibody (HRP)

KRT222P Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KA21, KRT222P

UniProt

Q8N1A0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KRT222P

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ELSQLLNEIRANYEKILTRNQIETVLSTRIQLEEDISKKMDKDEEALKAA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689562

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTC22-set siRNA/shRNA/RNAi Lentivector (Human)
48671091 4x 500 ng

TTC22-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Monkey CTD Phosphatase 1 ELISA kit
GTR10398926 96 Well

Monkey CTD Phosphatase 1 ELISA kit

Sign In for Pricing
View Details
AQP7P3 3'UTR Luciferase Stable Cell Line
TU001003 1.0 mL

AQP7P3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Rabbit Anti-Human S100P Monoclonal Antibody, clone CQ7129
CABT-Z193R 100 µl

Recombinant Rabbit Anti-Human S100P Monoclonal Antibody, clone CQ7129

Sign In for Pricing
View Details
NIRF (UHRF2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G10]
TA810211BM 100 µL

NIRF (UHRF2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G10]

Sign In for Pricing
View Details
W/W055/NL446/PP-450X150-1 Marine & IMO Signs (No Adhesive)
301559 1 Pack (1 Panel (s) x 1 Pack)

W/W055/NL446/PP-450X150-1 Marine & IMO Signs (No Adhesive)

Sign In for Pricing
View Details