Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFAIP8L1 Rabbit Polyclonal Antibody (Biotin)

TNFAIP8L1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TIPE1

UniProt

Q8WVP5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TNFAIP8L1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGSL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_689575

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALPK2 (Alpha-protein Kinase 2, Heart alpha-protein Kinase, HAK, FLJ34875, FLJ43253) (MaxLight 750)
MBS6231535-01 0.1 mL

ALPK2 (Alpha-protein Kinase 2, Heart alpha-protein Kinase, HAK, FLJ34875, FLJ43253) (MaxLight 750)

Sign In for Pricing
View Details
ALPK2 (Alpha-protein Kinase 2, Heart alpha-protein Kinase, HAK, FLJ34875, FLJ43253) (MaxLight 750)
MBS6231535-02 5x 0.1 mL

ALPK2 (Alpha-protein Kinase 2, Heart alpha-protein Kinase, HAK, FLJ34875, FLJ43253) (MaxLight 750)

Sign In for Pricing
View Details
Recombinant Shigella flexneri Phosphate import ATP-binding protein PstB (pstB)
MBS1202972-01 0.02 mg (E-Coli)

Recombinant Shigella flexneri Phosphate import ATP-binding protein PstB (pstB)

Sign In for Pricing
View Details
Recombinant Shigella flexneri Phosphate import ATP-binding protein PstB (pstB)
MBS1202972-02 0.1 mg (E-Coli)

Recombinant Shigella flexneri Phosphate import ATP-binding protein PstB (pstB)

Sign In for Pricing
View Details
Recombinant Shigella flexneri Phosphate import ATP-binding protein PstB (pstB)
MBS1202972-03 0.02 mg (Yeast)

Recombinant Shigella flexneri Phosphate import ATP-binding protein PstB (pstB)

Sign In for Pricing
View Details
Recombinant Shigella flexneri Phosphate import ATP-binding protein PstB (pstB)
MBS1202972-04 0.1 mg (Yeast)

Recombinant Shigella flexneri Phosphate import ATP-binding protein PstB (pstB)

Sign In for Pricing
View Details