Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prxl2b Rabbit Polyclonal Antibody (Biotin)

Prxl2b Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PM/P, Fam213, Fam213b, PM/PGFS, AI836168, 2810405K02Rik

UniProt

Q9DB60

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SKQIYKELGFKRYNSLSILPAALGKPVRDVASKAKAVGIQGNLSGDLLQS

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_079858

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to S100 Calcium Binding Protein A5 (S100A5)
TRV-0036871-01 20 µL

Monoclonal Antibody to S100 Calcium Binding Protein A5 (S100A5)

Sign In for Pricing
View Details
Monoclonal Antibody to S100 Calcium Binding Protein A5 (S100A5)
TRV-0036871-02 100 µL

Monoclonal Antibody to S100 Calcium Binding Protein A5 (S100A5)

Sign In for Pricing
View Details
Monoclonal Antibody to S100 Calcium Binding Protein A5 (S100A5)
TRV-0036871-03 200 µL

Monoclonal Antibody to S100 Calcium Binding Protein A5 (S100A5)

Sign In for Pricing
View Details
Monoclonal Antibody to S100 Calcium Binding Protein A5 (S100A5)
TRV-0036871-04 1 mL

Monoclonal Antibody to S100 Calcium Binding Protein A5 (S100A5)

Sign In for Pricing
View Details
APOA2 Antibody - middle region
OAAB20022-400UL 400 µL

APOA2 Antibody - middle region

Sign In for Pricing
View Details
LentimiRa-mmu-miR-873b Vector
mm42103 500 ng

LentimiRa-mmu-miR-873b Vector

Sign In for Pricing
View Details