Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prxl2b Rabbit Polyclonal Antibody (HRP)

Prxl2b Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PM/P, Fam213, Fam213b, PM/PGFS, AI836168, 2810405K02Rik

UniProt

Q9DB60

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SKQIYKELGFKRYNSLSILPAALGKPVRDVASKAKAVGIQGNLSGDLLQS

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_079858

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

FCN2 Antibody
orb1561298-01 50 µL

FCN2 Antibody

Sign In for Pricing
View Details
FCN2 Antibody
orb1561298-02 100 µL

FCN2 Antibody

Sign In for Pricing
View Details
FCN2 Antibody
orb1561298-03 200 µL

FCN2 Antibody

Sign In for Pricing
View Details
EDIL3 Human qPCR Primer Pair (NM_005711)
HP208800 200 Reactions

EDIL3 Human qPCR Primer Pair (NM_005711)

Sign In for Pricing
View Details
ORAI1 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-61611R-BF750-01 20 µL

ORAI1 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
ORAI1 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-61611R-BF750-02 100 µL

ORAI1 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details