Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRXL2B Rabbit Polyclonal Antibody (HRP)

PRXL2B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C1orf93, FAM213B

UniProt

Q5R7S9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C1orf93

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RYNSLSILPAALGKPVRDVAAKAKAVGIQGNLSGDLLQSGGLLVVSKGGD

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_689584

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLCB1 (1-Phosphatidylinositol-4,5 Bisphosphate Phosphodiesterase Beta 1, PLC-I, EIEE12, PI-PLC, PLC154, PLCB1A, PLCB1B, PLC-154) (MaxLight 650)
MBS6431883-01 0.1 mL

PLCB1 (1-Phosphatidylinositol-4,5 Bisphosphate Phosphodiesterase Beta 1, PLC-I, EIEE12, PI-PLC, PLC154, PLCB1A, PLCB1B, PLC-154) (MaxLight 650)

Sign In for Pricing
View Details
PLCB1 (1-Phosphatidylinositol-4,5 Bisphosphate Phosphodiesterase Beta 1, PLC-I, EIEE12, PI-PLC, PLC154, PLCB1A, PLCB1B, PLC-154) (MaxLight 650)
MBS6431883-02 5x 0.1 mL

PLCB1 (1-Phosphatidylinositol-4,5 Bisphosphate Phosphodiesterase Beta 1, PLC-I, EIEE12, PI-PLC, PLC154, PLCB1A, PLCB1B, PLC-154) (MaxLight 650)

Sign In for Pricing
View Details
Rno-miR-377-5p miRNA Inhibitor
orb1868526-01 10 nmol

Rno-miR-377-5p miRNA Inhibitor

Sign In for Pricing
View Details
Rno-miR-377-5p miRNA Inhibitor
orb1868526-02 20 nmol

Rno-miR-377-5p miRNA Inhibitor

Sign In for Pricing
View Details
FastScan™ Phospho-p44/42 MAPK (Thr202/Tyr204) ELISA Kit
CST 42173V3 20 Kit

FastScan™ Phospho-p44/42 MAPK (Thr202/Tyr204) ELISA Kit

Sign In for Pricing
View Details
2- (4-Methylcyclohex-3-en-1-yl) propane-2-thiol
OR1066703-01 1 g

2- (4-Methylcyclohex-3-en-1-yl) propane-2-thiol

Sign In for Pricing
View Details