Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

5730409E04Rik Rabbit Polyclonal Antibody (HRP)

5730409E04Rik Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AI849033, 7530403E16Rik

UniProt

Q8BP99

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RLALLQWIRALQHQLVDQQARLQESFDTILDNRKELIRCLQQREAPCRHQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001013777

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LY-3381916 100mg
A19483-100 100 mg

LY-3381916 100mg

Sign In for Pricing
View Details
CRHR2 Antibody
E38PA1274 100 µL

CRHR2 Antibody

Sign In for Pricing
View Details
RPS6KB1, CT (Ribosomal protein S6 kinase beta-1, Ribosomal protein S6 kinase I, S6K, S6K1, 70kD ribosomal protein S6 kinase 1, p70 S6 kinase alpha, p70 (S6K) -alpha, p70-S6K, P70S6K, p70-alpha, STK14A) discontinued
136395 50 µg

RPS6KB1, CT (Ribosomal protein S6 kinase beta-1, Ribosomal protein S6 kinase I, S6K, S6K1, 70kD ribosomal protein S6 kinase 1, p70 S6 kinase alpha, p70 (S6K) -alpha, p70-S6K, P70S6K, p70-alpha, STK14A) discontinued

Sign In for Pricing
View Details
LMNA (Lamin A, Prelamin-A/C, Lamin A/C, CDCD1, CDDC, CMD1A, CMT2B1, EMD2, FPL, FPLD, HGPS, IDC, LDP1, LFP, LGMD1B, LMN1, LMNC, PRO1) (MaxLight 490)
MBS6424852-01 0.1 mL

LMNA (Lamin A, Prelamin-A/C, Lamin A/C, CDCD1, CDDC, CMD1A, CMT2B1, EMD2, FPL, FPLD, HGPS, IDC, LDP1, LFP, LGMD1B, LMN1, LMNC, PRO1) (MaxLight 490)

Sign In for Pricing
View Details
LMNA (Lamin A, Prelamin-A/C, Lamin A/C, CDCD1, CDDC, CMD1A, CMT2B1, EMD2, FPL, FPLD, HGPS, IDC, LDP1, LFP, LGMD1B, LMN1, LMNC, PRO1) (MaxLight 490)
MBS6424852-02 5x 0.1 mL

LMNA (Lamin A, Prelamin-A/C, Lamin A/C, CDCD1, CDDC, CMD1A, CMT2B1, EMD2, FPL, FPLD, HGPS, IDC, LDP1, LFP, LGMD1B, LMN1, LMNC, PRO1) (MaxLight 490)

Sign In for Pricing
View Details
Recombinant Protease HtpX (htpX)
MBS7017058-01 0.02 mg

Recombinant Protease HtpX (htpX)

Sign In for Pricing
View Details