Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BBS5 Rabbit Polyclonal Antibody (Biotin)

BBS5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q8N3I7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human BBS5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MSVLDALWEDRDVRFDLSAQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_689597

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SPRY3 antibody
STJ116873 100 µl

Anti-SPRY3 antibody

Sign In for Pricing
View Details
LOC100130705 CRISPR Activation Plasmid (h)
sc-418698-ACT 20 µg

LOC100130705 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
IFFO2 Adenovirus (Mouse)
24207054 1.0 mL

IFFO2 Adenovirus (Mouse)

Sign In for Pricing
View Details
Insig1, NT (Insulin-induced gene 1 protein, INSIG-1, CL6, CL-6, MGC1405) (MaxLight 750) discontinued
I7655-85N-ML750 100 µL

Insig1, NT (Insulin-induced gene 1 protein, INSIG-1, CL6, CL-6, MGC1405) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Ngrn sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3430106 1.0 µg DNA

Ngrn sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Drop-out Mix Synthetic Minus Methionine, Adenine Rich (2g) w/o Yeast Nitrogen Base (DO, Dropout, Powder)
D9527-01 100 g

Drop-out Mix Synthetic Minus Methionine, Adenine Rich (2g) w/o Yeast Nitrogen Base (DO, Dropout, Powder)

Sign In for Pricing
View Details