Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BBS5 Rabbit Polyclonal Antibody (HRP)

BBS5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8N3I7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human BBS5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSVLDALWEDRDVRFDLSAQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_689597

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPM3 (NM_006993) Human Over-expression Lysate
LS010360-100ug 100 µg

NPM3 (NM_006993) Human Over-expression Lysate

Sign In for Pricing
View Details
ADA Rabbit Polyclonal Antibody (Fluoro488)
orb3075149 100 µg

ADA Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Migration And Invasion Enhancer 1 (MIEN1) Magnetic Fluorescence Assay Kit
MBS2161600-01 96 Tests

Migration And Invasion Enhancer 1 (MIEN1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Migration And Invasion Enhancer 1 (MIEN1) Magnetic Fluorescence Assay Kit
MBS2161600-02 5x 96 Tests

Migration And Invasion Enhancer 1 (MIEN1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Migration And Invasion Enhancer 1 (MIEN1) Magnetic Fluorescence Assay Kit
MBS2161600-03 10x 96 Tests

Migration And Invasion Enhancer 1 (MIEN1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
KCNT1 Protein Vector (Human) (pPM-C-His)
PV088617 500 ng

KCNT1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details