Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BBS5 Rabbit Polyclonal Antibody (Biotin)

BBS5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q8N3I7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human BBS5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VEIDSDGHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLW

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_689597

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lutetium (Lu) ICP Standard Solution 1.0 gm/L In 2% HNO3 Traceable To NIST-1000 ppm-2% v/v Nitric Acid
ICP111 00030 30 mL

Lutetium (Lu) ICP Standard Solution 1.0 gm/L In 2% HNO3 Traceable To NIST-1000 ppm-2% v/v Nitric Acid

Sign In for Pricing
View Details
TIMM9 (Mitochondrial Import Inner Membrane Translocase Subunit Tim9, TIM9, TIM9A) (FITC)
MBS6440689-01 0.1 mL

TIMM9 (Mitochondrial Import Inner Membrane Translocase Subunit Tim9, TIM9, TIM9A) (FITC)

Sign In for Pricing
View Details
TIMM9 (Mitochondrial Import Inner Membrane Translocase Subunit Tim9, TIM9, TIM9A) (FITC)
MBS6440689-02 5x 0.1 mL

TIMM9 (Mitochondrial Import Inner Membrane Translocase Subunit Tim9, TIM9, TIM9A) (FITC)

Sign In for Pricing
View Details
Small Ubiquitin Related Modifier Protein 1 (SUMO1) BioAssayTM ELISA Kit (Human)
153128 96 Tests

Small Ubiquitin Related Modifier Protein 1 (SUMO1) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
HIV-1 protease-IN-12
T79537-01 25 mg

HIV-1 protease-IN-12

Sign In for Pricing
View Details
HIV-1 protease-IN-12
T79537-02 50 mg

HIV-1 protease-IN-12

Sign In for Pricing
View Details