Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nudt16 Rabbit Polyclonal Antibody (Biotin)

Nudt16 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AI851783, 2310041H06Rik, 2810047L04Rik, 2900006H04Rik

UniProt

Q6P3D0

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VLMQMRFDGRLGFPGGFVDAQDSCLEDGLNRELREELGEAMSAFRVERSD

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_083661

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFKB p65 Monoclonal Antibody, AbBy Fluor™ 555 Conjugated
bsm-33059M-BF555-01 20 µL

NFKB p65 Monoclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
NFKB p65 Monoclonal Antibody, AbBy Fluor™ 555 Conjugated
bsm-33059M-BF555-02 100 µL

NFKB p65 Monoclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Recombinant Human Interleukin-18/IL-18/IL-1F4
CH29-500ug 500 µg

Recombinant Human Interleukin-18/IL-18/IL-1F4

Sign In for Pricing
View Details
JUN, phosphorylated (T289) (Jun, Transcription factor AP-1, AH119, Activator protein 1, Proto-oncogene c-Jun, V-jun avian sarcoma virus 17 oncogene homolog)
037228 200 µL

JUN, phosphorylated (T289) (Jun, Transcription factor AP-1, AH119, Activator protein 1, Proto-oncogene c-Jun, V-jun avian sarcoma virus 17 oncogene homolog)

Sign In for Pricing
View Details
SIGLEC3 (Sialic Acid Binding Ig Like Lectin 3) Porcine ELISA Kit
H0835 96 Tests

SIGLEC3 (Sialic Acid Binding Ig Like Lectin 3) Porcine ELISA Kit

Sign In for Pricing
View Details
c-Src (A16) Blocking Peptide
MBS443022-01 0.1 mg

c-Src (A16) Blocking Peptide

Sign In for Pricing
View Details