Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OCIAD2 Rabbit Polyclonal Antibody (FITC)

OCIAD2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DKFZp686C03164, MGC45416

UniProt

Q56VL3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human OCIAD2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QGYLAANSRFGSLPKVALAGLLGFGLGKVSYIGVCQSKFHFFEDQLRGAG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001014446

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Protein SSX2 (SSX2) ELISA Kit
AE15371HU-01 48 Tests

Human Protein SSX2 (SSX2) ELISA Kit

Sign In for Pricing
View Details
Human Protein SSX2 (SSX2) ELISA Kit
AE15371HU-02 96 Tests

Human Protein SSX2 (SSX2) ELISA Kit

Sign In for Pricing
View Details
CD5L, CT (CD5 Antigen-like, CD5 Molecule-like, AIM, API6, CT-2, IgM-associated Peptide, PRO229, SPalpha, SP-alpha) (MaxLight 650)
MBS6467959-01 0.1 mL

CD5L, CT (CD5 Antigen-like, CD5 Molecule-like, AIM, API6, CT-2, IgM-associated Peptide, PRO229, SPalpha, SP-alpha) (MaxLight 650)

Sign In for Pricing
View Details
CD5L, CT (CD5 Antigen-like, CD5 Molecule-like, AIM, API6, CT-2, IgM-associated Peptide, PRO229, SPalpha, SP-alpha) (MaxLight 650)
MBS6467959-02 5x 0.1 mL

CD5L, CT (CD5 Antigen-like, CD5 Molecule-like, AIM, API6, CT-2, IgM-associated Peptide, PRO229, SPalpha, SP-alpha) (MaxLight 650)

Sign In for Pricing
View Details
CNTF Polyclonal Antibody
MBS126893-01 0.02 mL

CNTF Polyclonal Antibody

Sign In for Pricing
View Details
CNTF Polyclonal Antibody
MBS126893-02 0.1 mL

CNTF Polyclonal Antibody

Sign In for Pricing
View Details