Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pdcl2 Rabbit Polyclonal Antibody (FITC)

Pdcl2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Mgcp, Tphlp, Mgcphlp, 1700010B22Rik, 1700016K07Rik

UniProt

Q78Y63

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Pdcl2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EKRLQEWKALKKKQKFGELREISGNQYVNEVTNAEKDLWVVIHLYRSSVP

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_075997

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SPNS3 sgRNA gene knockout kit - Lentiviral human SPNS3 sgRNA gene knockout kit (plasmid)
GTR15399509 1 Vial

Lentiviral human SPNS3 sgRNA gene knockout kit - Lentiviral human SPNS3 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
ACE2 Peptide - C-terminal region
MBS3247732-01 0.1 mg

ACE2 Peptide - C-terminal region

Sign In for Pricing
View Details
ACE2 Peptide - C-terminal region
MBS3247732-02 5x 0.1 mg

ACE2 Peptide - C-terminal region

Sign In for Pricing
View Details
Rabbit anti-GTPBP2 Antibody
DL94336A-01 50 µL

Rabbit anti-GTPBP2 Antibody

Sign In for Pricing
View Details
Rabbit anti-GTPBP2 Antibody
DL94336A-02 100 µL

Rabbit anti-GTPBP2 Antibody

Sign In for Pricing
View Details
Fibroblast Growth Factor 10, Recombinant, Mouse (FGF10)
F4212-05B 25 µg

Fibroblast Growth Factor 10, Recombinant, Mouse (FGF10)

Sign In for Pricing
View Details