Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIWIL4 Rabbit Polyclonal Antibody (HRP)

PIWIL4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HIWI2, MIWI2

UniProt

Q7Z3Z4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PIWIL4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSNNEASSSNGFLGTSRISTNDKYGISSGDAGSTFMERGVKNKQDFMDLS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

96

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_689644

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR10G9, CT (OR10G9, OR10G10P, Olfactory receptor 10G9, Olfactory receptor 10G10) (PE)
MBS6327952-01 0.2 mL

OR10G9, CT (OR10G9, OR10G10P, Olfactory receptor 10G9, Olfactory receptor 10G10) (PE)

Sign In for Pricing
View Details
OR10G9, CT (OR10G9, OR10G10P, Olfactory receptor 10G9, Olfactory receptor 10G10) (PE)
MBS6327952-02 5x 0.2 mL

OR10G9, CT (OR10G9, OR10G10P, Olfactory receptor 10G9, Olfactory receptor 10G10) (PE)

Sign In for Pricing
View Details
DCN, ID (DCN, Bone Proteoglycan II, CSCD, DSPG2, PG40, PGII, PGS2, Small Leucine Rich Protein 1B, SLRR1B) (Biotin) discontinued
D1875-06A-Biotin 200 µL

DCN, ID (DCN, Bone Proteoglycan II, CSCD, DSPG2, PG40, PGII, PGS2, Small Leucine Rich Protein 1B, SLRR1B) (Biotin) discontinued

Sign In for Pricing
View Details
MAPT, Phosphorylated (S396) (Tau Protein, Microtubule-associated Protein Tau, DDPAC, FLJ31424, FTDP-17, MAPTL, MGC138549, MSTD, MTBT1, MTBT2, PPND) (AP)
MBS6425957-01 0.1 mL

MAPT, Phosphorylated (S396) (Tau Protein, Microtubule-associated Protein Tau, DDPAC, FLJ31424, FTDP-17, MAPTL, MGC138549, MSTD, MTBT1, MTBT2, PPND) (AP)

Sign In for Pricing
View Details
MAPT, Phosphorylated (S396) (Tau Protein, Microtubule-associated Protein Tau, DDPAC, FLJ31424, FTDP-17, MAPTL, MGC138549, MSTD, MTBT1, MTBT2, PPND) (AP)
MBS6425957-02 5x 0.1 mL

MAPT, Phosphorylated (S396) (Tau Protein, Microtubule-associated Protein Tau, DDPAC, FLJ31424, FTDP-17, MAPTL, MGC138549, MSTD, MTBT1, MTBT2, PPND) (AP)

Sign In for Pricing
View Details
MOCS1P2 Recombinant Protein (Human)
RP075486 100 µg

MOCS1P2 Recombinant Protein (Human)

Sign In for Pricing
View Details