Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD9B Rabbit Polyclonal Antibody (Biotin)

RAD9B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FLJ40346, MGC75426

UniProt

Q6WBX8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RAD9B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SSVSNTEEVPGSLCLRKFSCMFFGAVSSDQQEHFNHPFDSLARASDSEED

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_689655

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AdmiRa-mmu-miR-6928-3p Virus
mm1580 250 µL

AdmiRa-mmu-miR-6928-3p Virus

Sign In for Pricing
View Details
DEPDC6 (DEP Domain-containing mTOR-interacting Protein, DEP Domain-containing Protein 6, DEPTOR, DKFZp564B1778, FLJ12341, FLJ12428, FLJ13854) (AP)
MBS6376018-01 0.1 mL

DEPDC6 (DEP Domain-containing mTOR-interacting Protein, DEP Domain-containing Protein 6, DEPTOR, DKFZp564B1778, FLJ12341, FLJ12428, FLJ13854) (AP)

Sign In for Pricing
View Details
DEPDC6 (DEP Domain-containing mTOR-interacting Protein, DEP Domain-containing Protein 6, DEPTOR, DKFZp564B1778, FLJ12341, FLJ12428, FLJ13854) (AP)
MBS6376018-02 5x 0.1 mL

DEPDC6 (DEP Domain-containing mTOR-interacting Protein, DEP Domain-containing Protein 6, DEPTOR, DKFZp564B1778, FLJ12341, FLJ12428, FLJ13854) (AP)

Sign In for Pricing
View Details
Recombinant Borrelia Turicatae rnz Protein (aa 1-319)
VAng-Lsx2545-1mgEcoli 1 mg (E. coli)

Recombinant Borrelia Turicatae rnz Protein (aa 1-319)

Sign In for Pricing
View Details
PINP (procollagen I N-terminal propeptide) Rabbit ELISA Kit
F8947 96 Tests

PINP (procollagen I N-terminal propeptide) Rabbit ELISA Kit

Sign In for Pricing
View Details
NF1 Antibody
MBS9608998-01 0.1 mL

NF1 Antibody

Sign In for Pricing
View Details