Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD9B Rabbit Polyclonal Antibody (HRP)

RAD9B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ40346, MGC75426

UniProt

Q6WBX8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RAD9B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSVSNTEEVPGSLCLRKFSCMFFGAVSSDQQEHFNHPFDSLARASDSEED

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_689655

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Optineurin/OPTN Antibody Picoband® (monoclonal, 3D8) Fluoro550 Conjugated
M00952-Fluoro550 100 µg/Vial

Anti-Optineurin/OPTN Antibody Picoband® (monoclonal, 3D8) Fluoro550 Conjugated

Sign In for Pricing
View Details
TRAF2 Rabbit Polyclonal Antibody (Biotin)
orb2575872 100 µg

TRAF2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Sheep Receptor Activity Modifying Protein 2 ELISA Kit
OM617320 96 Strip Well

Sheep Receptor Activity Modifying Protein 2 ELISA Kit

Sign In for Pricing
View Details
FGF10 Rabbit Polyclonal Antibody (FITC)
orb2606467 100 µg

FGF10 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Beta Dystroglycan Rabbit pAb
APA2226-01 30 µL

Beta Dystroglycan Rabbit pAb

Sign In for Pricing
View Details
Beta Dystroglycan Rabbit pAb
APA2226-02 50 μL

Beta Dystroglycan Rabbit pAb

Sign In for Pricing
View Details