Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RDH12 Rabbit Polyclonal Antibody (Biotin)

RDH12 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RP53, LCA13, SDR7C2

UniProt

Q96NR8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RDH12

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HIGKIPFHDLQSEKRYSRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_689656

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horse Growth Differentiation Factor 11 ELISA Kit
MBS043303-01 48 Well

Horse Growth Differentiation Factor 11 ELISA Kit

Sign In for Pricing
View Details
Horse Growth Differentiation Factor 11 ELISA Kit
MBS043303-02 96 Well

Horse Growth Differentiation Factor 11 ELISA Kit

Sign In for Pricing
View Details
Horse Growth Differentiation Factor 11 ELISA Kit
MBS043303-03 5x 96 Well

Horse Growth Differentiation Factor 11 ELISA Kit

Sign In for Pricing
View Details
Horse Growth Differentiation Factor 11 ELISA Kit
MBS043303-04 10x 96 Well

Horse Growth Differentiation Factor 11 ELISA Kit

Sign In for Pricing
View Details
ErbB4, phosphorylated (Tyr1162) (Receptor Tyrosine-protein Kinase erbB-4, Proto-oncogene-like Protein c-ErbB-4, p180erbB4, Tyrosine Kinase-type Cell Surface Receptor HER4, ERBB4) (FITC) discontinued
E3451-41P-FITC 200 µL

ErbB4, phosphorylated (Tyr1162) (Receptor Tyrosine-protein Kinase erbB-4, Proto-oncogene-like Protein c-ErbB-4, p180erbB4, Tyrosine Kinase-type Cell Surface Receptor HER4, ERBB4) (FITC) discontinued

Sign In for Pricing
View Details
PatD Antibody
orb808858 2 mg

PatD Antibody

Sign In for Pricing
View Details