Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RDH12 Rabbit Polyclonal Antibody (HRP)

RDH12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RP53, LCA13, SDR7C2

UniProt

Q96NR8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RDH12

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AKRLQGTGVTTYAVHPGVVRSELVRHSSLLCLLWRLFSPFVKTAREGAQT

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_689656

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAD2 (Glutamate Decarboxylase 2 (Pancreatic Islets and Brain, 65kD), GAD65, MGC161605, MGC161607) (Biotin)
246443-Biotin 100 µL

GAD2 (Glutamate Decarboxylase 2 (Pancreatic Islets and Brain, 65kD), GAD65, MGC161605, MGC161607) (Biotin)

Sign In for Pricing
View Details
Anti-CROP/LUC7L3 Antibody Picoband®, Cy3 Conjugate
A08633-3-Cy3 100 µg/Vial

Anti-CROP/LUC7L3 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
APOBEC2 (Apolipoprotein B mRNA editing Enzyme, Catalytic Polypeptide-like 2, ARCD1, ARP1) (MaxLight 550)
243410-ML550 100 µL

APOBEC2 (Apolipoprotein B mRNA editing Enzyme, Catalytic Polypeptide-like 2, ARCD1, ARP1) (MaxLight 550)

Sign In for Pricing
View Details
RG9MTD1 antibody
MBS838974-01 0.1 mL

RG9MTD1 antibody

Sign In for Pricing
View Details
RG9MTD1 antibody
MBS838974-02 5x 0.1 mL

RG9MTD1 antibody

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Interleukin 2 (IL2)
MBS2036867-01 0.1 mL

PE-Linked Monoclonal Antibody to Interleukin 2 (IL2)

Sign In for Pricing
View Details