Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EME1 Rabbit Polyclonal Antibody (FITC)

EME1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MMS4L, SLX2A

UniProt

Q96AY2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human EME1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGEGVTSTSRRIGPELSRR

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689676

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MED22, NT (MED22, SURF5, Mediator of RNA polymerase II transcription subunit 22, Mediator complex subunit 22, Surfeit locus protein 5) (AP)
MBS6319990-01 0.2 mL

MED22, NT (MED22, SURF5, Mediator of RNA polymerase II transcription subunit 22, Mediator complex subunit 22, Surfeit locus protein 5) (AP)

Sign In for Pricing
View Details
MED22, NT (MED22, SURF5, Mediator of RNA polymerase II transcription subunit 22, Mediator complex subunit 22, Surfeit locus protein 5) (AP)
MBS6319990-02 5x 0.2 mL

MED22, NT (MED22, SURF5, Mediator of RNA polymerase II transcription subunit 22, Mediator complex subunit 22, Surfeit locus protein 5) (AP)

Sign In for Pricing
View Details
TMEM60 Lentiviral Activation Particles (h2)
sc-417119-LAC-2 200 µL

TMEM60 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Rabbit Polyclonal CARD14 Antibody [mFluor Violet 500 SE]
NBP2-81901MFV500 0.1 mL

Rabbit Polyclonal CARD14 Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Chicken ATP binding cassette sub family G member 5 (ABCG5) ELISA kit
GTR10445086 96 Well

Chicken ATP binding cassette sub family G member 5 (ABCG5) ELISA kit

Sign In for Pricing
View Details
C20orf27 shRNA Plasmid (m)
sc-141867-SH 20 µg

C20orf27 shRNA Plasmid (m)

Sign In for Pricing
View Details