Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1orf74 Rabbit Polyclonal Antibody (HRP)

C1orf74 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

URLC4

UniProt

Q96LT6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C1orf74

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ICLHLAGEVLAVARGLKPAVLYDCNCAGASELQSYLEELKGLGFLTFGLH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689698

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A, Recombinant, Human, aa93-535, His-Tag
583562-01 20 µg

Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A, Recombinant, Human, aa93-535, His-Tag

Sign In for Pricing
View Details
Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A, Recombinant, Human, aa93-535, His-Tag
583562-02 100 µg

Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A, Recombinant, Human, aa93-535, His-Tag

Sign In for Pricing
View Details
Rat Phosphoinositide-3-Kinase Catalytic Delta Polypeptide ELISA Kit
MBS108750-01 48 Well

Rat Phosphoinositide-3-Kinase Catalytic Delta Polypeptide ELISA Kit

Sign In for Pricing
View Details
Rat Phosphoinositide-3-Kinase Catalytic Delta Polypeptide ELISA Kit
MBS108750-02 96 Well

Rat Phosphoinositide-3-Kinase Catalytic Delta Polypeptide ELISA Kit

Sign In for Pricing
View Details
Rat Phosphoinositide-3-Kinase Catalytic Delta Polypeptide ELISA Kit
MBS108750-03 5x 96 Well

Rat Phosphoinositide-3-Kinase Catalytic Delta Polypeptide ELISA Kit

Sign In for Pricing
View Details
Rat Phosphoinositide-3-Kinase Catalytic Delta Polypeptide ELISA Kit
MBS108750-04 10x 96 Well

Rat Phosphoinositide-3-Kinase Catalytic Delta Polypeptide ELISA Kit

Sign In for Pricing
View Details