Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KANSL1L Rabbit Polyclonal Antibody (FITC)

KANSL1L Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MSL1v2, C2orf67

UniProt

A0AUZ9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human KANSL1L

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TWLQAQISDLECKIQQLTDIHRQIRASKGIVVLEECQLPKDILKKQMQFA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM147 Rabbit pAb, AP conjugated
orb2880476 100 µL

TMEM147 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
IFI44 (NM_006417) Human Tagged ORF Clone Lentiviral Particle
RC205042L1V 200 µL

IFI44 (NM_006417) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Pinus thunbergii Photosystem I assembly protein Ycf4 (ycf4)
MBS7033884-01 0.02 mg

Recombinant Pinus thunbergii Photosystem I assembly protein Ycf4 (ycf4)

Sign In for Pricing
View Details
Recombinant Pinus thunbergii Photosystem I assembly protein Ycf4 (ycf4)
MBS7033884-02 0.1 mg

Recombinant Pinus thunbergii Photosystem I assembly protein Ycf4 (ycf4)

Sign In for Pricing
View Details
Recombinant Pinus thunbergii Photosystem I assembly protein Ycf4 (ycf4)
MBS7033884-03 5x 0.1 mg

Recombinant Pinus thunbergii Photosystem I assembly protein Ycf4 (ycf4)

Sign In for Pricing
View Details
P/P004/NT/TW-DIA315-1 Prohibited Activity Signs & Labels (Adhesive)
234751 1 Pack (1 Panel (s) x 1 Pack)

P/P004/NT/TW-DIA315-1 Prohibited Activity Signs & Labels (Adhesive)

Sign In for Pricing
View Details