Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KANSL1L Rabbit Polyclonal Antibody (HRP)

KANSL1L Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MSL1v2, C2orf67

UniProt

A0AUZ9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human KANSL1L

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TWLQAQISDLECKIQQLTDIHRQIRASKGIVVLEECQLPKDILKKQMQFA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Zinc finger protein 526, Znf526 ELISA KIT
ELI-14794m 96 Tests

Mouse Zinc finger protein 526, Znf526 ELISA KIT

Sign In for Pricing
View Details
SKAP1 Protein Vector (Mouse) (pPM-C-HA)
43826024 500 ng

SKAP1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Interstitial Collagenase (MMP1) CLIA Kit
abx196015-01 96 Tests

Mouse Interstitial Collagenase (MMP1) CLIA Kit

Sign In for Pricing
View Details
Mouse Interstitial Collagenase (MMP1) CLIA Kit
abx196015-02 5x 96 Tests

Mouse Interstitial Collagenase (MMP1) CLIA Kit

Sign In for Pricing
View Details
Mouse Interstitial Collagenase (MMP1) CLIA Kit
abx196015-03 10x 96 Tests

Mouse Interstitial Collagenase (MMP1) CLIA Kit

Sign In for Pricing
View Details
V6 Mouse IgG3-kappa Isotype control
B21549327-01 1 mg

V6 Mouse IgG3-kappa Isotype control

Sign In for Pricing
View Details