Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Scfd2 Rabbit Polyclonal Antibody (HRP)

Scfd2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

STXBP, STXBP1L1, E430013M20Rik

UniProt

Q3TR67

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LVSGLSSLCEHLGVREECFAVGPLSRVIATDLANYAPAKNRKKTATGRAS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_848787

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdc23 rabbit pAb Antibody
orb764800-01 50 μL

Cdc23 rabbit pAb Antibody

Sign In for Pricing
View Details
Cdc23 rabbit pAb Antibody
orb764800-02 100 µL

Cdc23 rabbit pAb Antibody

Sign In for Pricing
View Details
Recombinant Human BLK Protein, N-His
HW362012-01 50 µg

Recombinant Human BLK Protein, N-His

Sign In for Pricing
View Details
Recombinant Human BLK Protein, N-His
HW362012-02 100 µg

Recombinant Human BLK Protein, N-His

Sign In for Pricing
View Details
Recombinant Human BLK Protein, N-His
HW362012-03 1 mg

Recombinant Human BLK Protein, N-His

Sign In for Pricing
View Details
Goat Anti-Chicken IgY H&L (Cy5), 1 pack = 500 µL
BAL6395 1 Each

Goat Anti-Chicken IgY H&L (Cy5), 1 pack = 500 µL

Sign In for Pricing
View Details