Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTNL9 Rabbit Polyclonal Antibody (FITC)

BTNL9 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BTN3, BTN8, VDLS1900

UniProt

Q6UXG8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human BTNL9

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DKGTYGCRFHSDNFSGEALWELEVAGLGSDPHLSLEGFKEGGIQLRLRSS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Antibody Discovery - Human PD-L1 / B7-H1 Membrane Protein, PaRoom Temperatureial, -Llama IgG2b Fc tag, low endotoxin
MP1456F Each

Magic™ Antibody Discovery - Human PD-L1 / B7-H1 Membrane Protein, PaRoom Temperatureial, -Llama IgG2b Fc tag, low endotoxin

Sign In for Pricing
View Details
Rfesd sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3706904 1.0 µg DNA

Rfesd sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Monkey ATP synthase subunit f, mitochondrial (ATP5J2) ELISA kit
GTR10408556 96 Well

Monkey ATP synthase subunit f, mitochondrial (ATP5J2) ELISA kit

Sign In for Pricing
View Details
FANCA Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV710045 1.0 µg DNA

FANCA Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
HNRNPA1P12 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV763356 1.0 µg DNA

HNRNPA1P12 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
OAAV00021-200UG - His tag - C-terminal region Antibody
OAAV00021-200UG 200µg

OAAV00021-200UG - His tag - C-terminal region Antibody

Sign In for Pricing
View Details