Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C12orf50 Rabbit Polyclonal Antibody (HRP)

C12orf50 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ35821

UniProt

Q8NA57

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C12orf50

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: INGLFLPPSSNITLQKEIQEGIPLQSQSQEPLKPQENISRPIHHPLVLKT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689802

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Chemerin ELISA kit
GTR10471872 96 Well

Rat Chemerin ELISA kit

Sign In for Pricing
View Details
VU 0357121
B1629-25 25 mg

VU 0357121

Sign In for Pricing
View Details
TIP47 (M6PRBP1, Perilipin-3, 47kD Mannose 6-phosphate Receptor-binding Protein, 47kD MPR-binding Protein, Cargo Selection Protein TIP47, Mannose-6-phosphate Receptor-binding Protein 1, Placental Protein 17, PP17, PLIN3) (MaxLight 750)
MBS6235774-01 0.1 mL

TIP47 (M6PRBP1, Perilipin-3, 47kD Mannose 6-phosphate Receptor-binding Protein, 47kD MPR-binding Protein, Cargo Selection Protein TIP47, Mannose-6-phosphate Receptor-binding Protein 1, Placental Protein 17, PP17, PLIN3) (MaxLight 750)

Sign In for Pricing
View Details
TIP47 (M6PRBP1, Perilipin-3, 47kD Mannose 6-phosphate Receptor-binding Protein, 47kD MPR-binding Protein, Cargo Selection Protein TIP47, Mannose-6-phosphate Receptor-binding Protein 1, Placental Protein 17, PP17, PLIN3) (MaxLight 750)
MBS6235774-02 5x 0.1 mL

TIP47 (M6PRBP1, Perilipin-3, 47kD Mannose 6-phosphate Receptor-binding Protein, 47kD MPR-binding Protein, Cargo Selection Protein TIP47, Mannose-6-phosphate Receptor-binding Protein 1, Placental Protein 17, PP17, PLIN3) (MaxLight 750)

Sign In for Pricing
View Details
Rabbit DGCR8 IHC Antibody
orb1517644-01 10 µL

Rabbit DGCR8 IHC Antibody

Sign In for Pricing
View Details
Rabbit DGCR8 IHC Antibody
orb1517644-02 100 µL

Rabbit DGCR8 IHC Antibody

Sign In for Pricing
View Details