Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC63 Rabbit Polyclonal Antibody (HRP)

CCDC63 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ODA5

UniProt

Q8NA47

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CCDC63

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EQSSQAYEQRVEAMARMAAMKDRQKKDTSQYNLEIRELERLYAHESKLKS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689804

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Claspin Antibody [Alexa Fluor 700]
NB100-247AF700 0.1 mL

Rabbit Polyclonal Claspin Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Mouse Monoclonal BRCA1 Antibody (MU) [HRP]
NB100-600H 0.1 mL

Mouse Monoclonal BRCA1 Antibody (MU) [HRP]

Sign In for Pricing
View Details
Human Monoclonal Anti-Norovirus GII.4 IgG1 (blocks binding of VLP to carbohydrate domain)
MNV15-M 100 µL

Human Monoclonal Anti-Norovirus GII.4 IgG1 (blocks binding of VLP to carbohydrate domain)

Sign In for Pricing
View Details
Anti-Cathepsin K (Marker of Tumor Invasiveness) Monoclonal Antibody (Clone: CTSK/2791)
36-2148-100 100 µg

Anti-Cathepsin K (Marker of Tumor Invasiveness) Monoclonal Antibody (Clone: CTSK/2791)

Sign In for Pricing
View Details
PPARα siRNA (m)
sc-36308 10 µM

PPARα siRNA (m)

Sign In for Pricing
View Details
Cullin 4A (Cullin-4A, CUL-4A, CUL4A) (Biotin)
125483-Biotin 100 µL

Cullin 4A (Cullin-4A, CUL-4A, CUL4A) (Biotin)

Sign In for Pricing
View Details