Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LEXM Rabbit Polyclonal Antibody (HRP)

LEXM Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LEM, C1orf177

UniProt

Q3ZCV2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C1orf177

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YSMQKKKPRELMNFKSFVEELNSHHNKKHGVFSKLPRNPKTPTERIYWAN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689820

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kinesis KX Syringe Filter; PVDF 4mm 0.45um
FIL1192 1000 / PCK

Kinesis KX Syringe Filter; PVDF 4mm 0.45um

Sign In for Pricing
View Details
Angpt2 Antibody (Biotin)
orb240823-01 50 µg

Angpt2 Antibody (Biotin)

Sign In for Pricing
View Details
Angpt2 Antibody (Biotin)
orb240823-02 100 µg

Angpt2 Antibody (Biotin)

Sign In for Pricing
View Details
Bovine Activating Transcription Factor 3 ELISA Kit
MBS007036-01 48 Well

Bovine Activating Transcription Factor 3 ELISA Kit

Sign In for Pricing
View Details
Bovine Activating Transcription Factor 3 ELISA Kit
MBS007036-02 96 Well

Bovine Activating Transcription Factor 3 ELISA Kit

Sign In for Pricing
View Details
Bovine Activating Transcription Factor 3 ELISA Kit
MBS007036-03 5x 96 Well

Bovine Activating Transcription Factor 3 ELISA Kit

Sign In for Pricing
View Details