Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1orf55 Rabbit Polyclonal Antibody (HRP)

C1orf55 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C1orf55, dJ671D7.1

UniProt

Q6IQ49

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human C1orf55

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AFTSVAELELLGLEKLKCELMALGLKCGGTLQERAARLFSVRGLAKEQID

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_689821

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNF 4 alpha (HNF4A) (N-term) Rabbit Polyclonal Antibody
AP52067PU-N 400 µL

HNF 4 alpha (HNF4A) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IFluor® 594-streptavidin conjugate
16962-AAT 200 µg

IFluor® 594-streptavidin conjugate

Sign In for Pricing
View Details
CD146 / MCAM / MUC18 / Mucin 18 (C146/634), Biotin conjugate, 0.1mg/mL
BNCB0634-500 1x 500 µL

CD146 / MCAM / MUC18 / Mucin 18 (C146/634), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FNC Coating Mix® - Human Proteins, 100ml
0407H 100 mL

FNC Coating Mix® - Human Proteins, 100ml

Sign In for Pricing
View Details
Mouse Catenin Beta 1 (CTNNb1) ELISA Kit
RD-CTNNb1-Mu-01 96 Tests

Mouse Catenin Beta 1 (CTNNb1) ELISA Kit

Sign In for Pricing
View Details
Mouse Catenin Beta 1 (CTNNb1) ELISA Kit
RD-CTNNb1-Mu-02 48 Tests

Mouse Catenin Beta 1 (CTNNb1) ELISA Kit

Sign In for Pricing
View Details