Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TENT5D Rabbit Polyclonal Antibody (HRP)

TENT5D Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CT112, CT1.26, FAM46D

UniProt

Q8NEK8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FAM46D

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LPNTQKVTCFYQPAPYFAAEARYPIYVIPEPPPVSFQPYHPLHFRGSNGM

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_689843

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRPP (human)
4044528.1 1 mg

GRPP (human)

Sign In for Pricing
View Details
Recombinant Salmonella agona Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)
MBS7008062-01 0.02 mg

Recombinant Salmonella agona Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Sign In for Pricing
View Details
Recombinant Salmonella agona Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)
MBS7008062-02 0.1 mg

Recombinant Salmonella agona Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Sign In for Pricing
View Details
Recombinant Salmonella agona Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)
MBS7008062-03 5x 0.1 mg

Recombinant Salmonella agona Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Sign In for Pricing
View Details
Anti-FGF19 Antibody Picoband® (Dylight550 Conjugate)
PB10061-Dylight550 100 µg

Anti-FGF19 Antibody Picoband® (Dylight550 Conjugate)

Sign In for Pricing
View Details
Chicken S-Adenosyl-L-homocysteine (SAH) ELISA Kit
MBS2605820-01 48 Well

Chicken S-Adenosyl-L-homocysteine (SAH) ELISA Kit

Sign In for Pricing
View Details