Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GGN Rabbit Polyclonal Antibody (HRP)

GGN Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ35713, MGC33369

UniProt

Q86UU5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GGN

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GPSKWQKPAGTPVPRIRRLLEASHRGQGDPPSLRPLKPPPPPRQLSVKDT

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689870

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT1 Polyclonal Antibody
D-AB-10285L-01 25 µL

STAT1 Polyclonal Antibody

Sign In for Pricing
View Details
STAT1 Polyclonal Antibody
D-AB-10285L-02 100 µL

STAT1 Polyclonal Antibody

Sign In for Pricing
View Details
Human GCP-2 Antibody Pair Set
E-KAB-0408 50 µL & 100 µg

Human GCP-2 Antibody Pair Set

Sign In for Pricing
View Details
Human CT47A8 activation kit by CRISPRa
GA118902 1 Kit

Human CT47A8 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS629319 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
CD134, Mouse (OX40) (OX-86), CF640R conjugate, 0.1mg/mL
BNC402004-500 1x 500 µL

CD134, Mouse (OX40) (OX-86), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details