Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM76A Rabbit Polyclonal Antibody (HRP)

FAM76A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC34648, RP3-426I6.1

UniProt

Q8TAV0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FAM76A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_689873

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Srrd Pre-designed siRNA Set A
SI213771A 1 Each

Rat Srrd Pre-designed siRNA Set A

Sign In for Pricing
View Details
PIGX (NM_001166304) Human Recombinant Protein
E45H33204M5 20 µg

PIGX (NM_001166304) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Ttc23l (NM_029430) AAV Particle
MR220139A1V 250 µL

Mouse Ttc23l (NM_029430) AAV Particle

Sign In for Pricing
View Details
Trim39 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7300802 1.0 µg DNA

Trim39 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Recombinant Clostridium Difficile secA1 Protein (aa 1-891)
VAng-Lsx9353-inquire Inquire

Recombinant Clostridium Difficile secA1 Protein (aa 1-891)

Sign In for Pricing
View Details
MPN Domain-Containing Protein (MPND) Antibody
abx235284 100 µg

MPN Domain-Containing Protein (MPND) Antibody

Sign In for Pricing
View Details