Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM76A Rabbit Polyclonal Antibody (Biotin)

FAM76A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MGC34648, RP3-426I6.1

UniProt

Q8TAV0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FAM76A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTKEQRKHLSSSSRAGHQE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_689873

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL4 CRISPR Knock Out 293T Cell Line (Human)
30483141 1x 10^6 Cells / 1.0 mL

MRPL4 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Recombinant Human TRPA1 Protein, N-His
bs-106920P-01 20 µg

Recombinant Human TRPA1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TRPA1 Protein, N-His
bs-106920P-02 50 µg

Recombinant Human TRPA1 Protein, N-His

Sign In for Pricing
View Details
Mouse Alg3 activation kit by CRISPRa
GA212876 1 Kit

Mouse Alg3 activation kit by CRISPRa

Sign In for Pricing
View Details
SEC14L4, NT (SEC14L4, TAP3, SEC14-like protein 4, Tocopherol-associated protein 3) (AP)
MBS6345734-01 0.2 mL

SEC14L4, NT (SEC14L4, TAP3, SEC14-like protein 4, Tocopherol-associated protein 3) (AP)

Sign In for Pricing
View Details
SEC14L4, NT (SEC14L4, TAP3, SEC14-like protein 4, Tocopherol-associated protein 3) (AP)
MBS6345734-02 5x 0.2 mL

SEC14L4, NT (SEC14L4, TAP3, SEC14-like protein 4, Tocopherol-associated protein 3) (AP)

Sign In for Pricing
View Details