Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM76A Rabbit Polyclonal Antibody (HRP)

FAM76A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC34648, RP3-426I6.1

UniProt

Q8TAV0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FAM76A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTKEQRKHLSSSSRAGHQE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_689873

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig Fibronectin type III domain containing protein 9 (C5orf40) ELISA kit
GTR10374801 96 Well

Guinea Pig Fibronectin type III domain containing protein 9 (C5orf40) ELISA kit

Sign In for Pricing
View Details
Mouse Suppressor of cytokine signaling 7 (SOCS7) ELISA Kit
abx546668 96 Tests

Mouse Suppressor of cytokine signaling 7 (SOCS7) ELISA Kit

Sign In for Pricing
View Details
4930455C21Rik 3'UTR Lenti-reporter-Luc Vector
10631084 1.0 µg

4930455C21Rik 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
RARRES2 Recombinant Protein
OPCD02195-50UG 50 µg

RARRES2 Recombinant Protein

Sign In for Pricing
View Details
hsa-miR-4802-5p miRNA Agomir
MBS8312409-01 5 nmol

hsa-miR-4802-5p miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-4802-5p miRNA Agomir
MBS8312409-02 10 nmol

hsa-miR-4802-5p miRNA Agomir

Sign In for Pricing
View Details