Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO15 Rabbit Polyclonal Antibody (FITC)

FBXO15 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FBX15

UniProt

Q8NCQ5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FBXO15

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QDKEAGYWKKEYITKQIASVKAALADILKPVNPYTGLPVKTKEALRIFGL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689889

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NIT1 Rabbit mAb
E2R25159 100 µL

NIT1 Rabbit mAb

Sign In for Pricing
View Details
SH3KBP1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
43681064 1.0 µg DNA

SH3KBP1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
DCC1, NT (Sister Chromatid Cohesion Protein DCC1, Defective In Sister Chromatid Cohesion Protein 1 Homolog, UNQ9337/PRO34008, DSCC1) (APC)
MBS6471966-01 0.2 mL

DCC1, NT (Sister Chromatid Cohesion Protein DCC1, Defective In Sister Chromatid Cohesion Protein 1 Homolog, UNQ9337/PRO34008, DSCC1) (APC)

Sign In for Pricing
View Details
DCC1, NT (Sister Chromatid Cohesion Protein DCC1, Defective In Sister Chromatid Cohesion Protein 1 Homolog, UNQ9337/PRO34008, DSCC1) (APC)
MBS6471966-02 5x 0.2 mL

DCC1, NT (Sister Chromatid Cohesion Protein DCC1, Defective In Sister Chromatid Cohesion Protein 1 Homolog, UNQ9337/PRO34008, DSCC1) (APC)

Sign In for Pricing
View Details
Bcl10 Recombinant Rabbit Monoclonal Antibody
orb559059-01 50 μL

Bcl10 Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Bcl10 Recombinant Rabbit Monoclonal Antibody
orb559059-02 100 µL

Bcl10 Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details