Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIBADH Rabbit Polyclonal Antibody (Biotin)

HIBADH Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NS5ATP1

UniProt

P31937

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HIBADH

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMG

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_689953

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-12 R beta 1/CD212 Recombinant Protein Fc Tag Lyophilized
MBS8432328-01 0.1 mg

Human IL-12 R beta 1/CD212 Recombinant Protein Fc Tag Lyophilized

Sign In for Pricing
View Details
Human IL-12 R beta 1/CD212 Recombinant Protein Fc Tag Lyophilized
MBS8432328-02 5x 0.1 mg

Human IL-12 R beta 1/CD212 Recombinant Protein Fc Tag Lyophilized

Sign In for Pricing
View Details
Mouse Anti Sheep Cd5 Monoclonal Antibody,RPE
DMABT-45231MS 100 TEST

Mouse Anti Sheep Cd5 Monoclonal Antibody,RPE

Sign In for Pricing
View Details
TGFBR3 Specific Rabbit Polyclonal Antibody
orb395674-01 50 µg

TGFBR3 Specific Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TGFBR3 Specific Rabbit Polyclonal Antibody
orb395674-02 100 µg

TGFBR3 Specific Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Gm1973 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
58212154 3x 1.0 µg DNA

Gm1973 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details