Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIBADH Rabbit Polyclonal Antibody (FITC)

HIBADH Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NS5ATP1

UniProt

P31937

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HIBADH

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMG

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_689953

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdon Mouse shRNA Plasmid (Locus ID 57810)
TR511901 1 Kit

Cdon Mouse shRNA Plasmid (Locus ID 57810)

Sign In for Pricing
View Details
In vivo Grade Recombinant MOPC-21 Mouse IgG2a Isotype Control Antibody
SA155.m2a 5 mg

In vivo Grade Recombinant MOPC-21 Mouse IgG2a Isotype Control Antibody

Sign In for Pricing
View Details
Ankrd34a (NM_001024851) Mouse Tagged Lenti ORF Clone
MR214346L3 10 µg

Ankrd34a (NM_001024851) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral mouse Fzd2 shRNA (UAS) - Lentiviral mouse Fzd2 shRNA (UAS, iRFP) plasmid
GTR15167572 1 Vial

Lentiviral mouse Fzd2 shRNA (UAS) - Lentiviral mouse Fzd2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Fibronectin Type III Domain-Containing Protein 7 (FNDC7) Antibody
abx307741-01 20 µg

Fibronectin Type III Domain-Containing Protein 7 (FNDC7) Antibody

Sign In for Pricing
View Details
Fibronectin Type III Domain-Containing Protein 7 (FNDC7) Antibody
abx307741-02 50 µg

Fibronectin Type III Domain-Containing Protein 7 (FNDC7) Antibody

Sign In for Pricing
View Details