Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ODF4 Rabbit Polyclonal Antibody (HRP)

ODF4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CT134, CT136, OPPO1

UniProt

Q2M2E3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ODF4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_694552

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HAPLN2 Pre-designed siRNA Set B
SI006902B 1 Each

Human HAPLN2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Rabbit Polyclonal Chromogranin A Antibody [Alexa Fluor 750]
NB120-15160AF750 0.1 mL

Rabbit Polyclonal Chromogranin A Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
Recombinant Human CRLF2 protein, C-His tag
IMP-780 10 µg

Recombinant Human CRLF2 protein, C-His tag

Sign In for Pricing
View Details
5-Nitro-2- (propan-2-ylsulfanyl) benzoic acid
XKB37712-01 100 mg

5-Nitro-2- (propan-2-ylsulfanyl) benzoic acid

Sign In for Pricing
View Details
5-Nitro-2- (propan-2-ylsulfanyl) benzoic acid
XKB37712-02 1 g

5-Nitro-2- (propan-2-ylsulfanyl) benzoic acid

Sign In for Pricing
View Details
Lentiviral human PPP1R32 sgRNA gene knockout kit - Lentiviral human PPP1R32 sgRNA gene knockout kit (100)
GTR15381322 1 Vial

Lentiviral human PPP1R32 sgRNA gene knockout kit - Lentiviral human PPP1R32 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details