Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lacc1 Rabbit Polyclonal Antibody (FITC)

Lacc1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

9030625A04Rik

UniProt

Q8BZT9

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LERGGILPQNIQDQKEDLDLCTSCHPEKFFSHVRDGLNFGTQIGFISLRE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_766076

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

MGC34821 Protein Vector (Human) (pPM-C-His)
PV025816 500 ng

MGC34821 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Ccdc15 Mouse shRNA Plasmid (Locus ID 245902)
TL518159 1 Kit

Ccdc15 Mouse shRNA Plasmid (Locus ID 245902)

Sign In for Pricing
View Details
WIPI2 (2A2), CF594 conjugate, 0.1mg/mL
BNC942904-500 1x 500 µL

WIPI2 (2A2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CNTD (CNTD1) Human Gene Knockout Kit (CRISPR)
KN406108 1 Kit

CNTD (CNTD1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MPP1, ID (MPP1, DXS552E, EMP55, 55kD erythrocyte membrane protein, Membrane protein, palmitoylated 1) (MaxLight 490)
MBS6321928-01 0.1 mL

MPP1, ID (MPP1, DXS552E, EMP55, 55kD erythrocyte membrane protein, Membrane protein, palmitoylated 1) (MaxLight 490)

Sign In for Pricing
View Details
MPP1, ID (MPP1, DXS552E, EMP55, 55kD erythrocyte membrane protein, Membrane protein, palmitoylated 1) (MaxLight 490)
MBS6321928-02 5x 0.1 mL

MPP1, ID (MPP1, DXS552E, EMP55, 55kD erythrocyte membrane protein, Membrane protein, palmitoylated 1) (MaxLight 490)

Sign In for Pricing
View Details