Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPESP Rabbit Polyclonal Antibody (HRP)

RPESP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RPESP, C8orf84

UniProt

Q8IVN8

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RPESP

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_694957

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cornulin (CRNN) Mouse Monoclonal Antibody [Clone ID: LBI4B8]
AMM20479VCF 100 µg

Cornulin (CRNN) Mouse Monoclonal Antibody [Clone ID: LBI4B8]

Sign In for Pricing
View Details
Lentiviral human ERG shRNA (UAS) - Lentiviral human ERG shRNA (UAS, GFP) plasmid
GTR15084406 1 Vial

Lentiviral human ERG shRNA (UAS) - Lentiviral human ERG shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Angiomotin like 1 (AMOTL1) CytoSection
TS407693P5 25 Slides

Angiomotin like 1 (AMOTL1) CytoSection

Sign In for Pricing
View Details
MINDY2 CytoSection
TS413021P5 25 Slides

MINDY2 CytoSection

Sign In for Pricing
View Details
Dabigatran ethyl ester
MBS3840810-01 5 mg

Dabigatran ethyl ester

Sign In for Pricing
View Details
Dabigatran ethyl ester
MBS3840810-02 10 mg

Dabigatran ethyl ester

Sign In for Pricing
View Details