Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPESP Rabbit Polyclonal Antibody (HRP)

RPESP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RPESP, C8orf84

UniProt

Q8IVN8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RPESP

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_694957

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Human BMG/β2-MG (Beta-2-Microglobulin) ELISA Kit
E-UNEL-H0005-01 5x 96 Tests

Uncoated Human BMG/β2-MG (Beta-2-Microglobulin) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human BMG/β2-MG (Beta-2-Microglobulin) ELISA Kit
E-UNEL-H0005-02 15x 96 Tests

Uncoated Human BMG/β2-MG (Beta-2-Microglobulin) ELISA Kit

Sign In for Pricing
View Details
Rcn2 AAV siRNA Pooled Vector
38751166 1.0 µg

Rcn2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Mouse C-type lectin domain family 18 member A (CLEC18A) ELISA Kit
MBS7246054-01 48 Well

Mouse C-type lectin domain family 18 member A (CLEC18A) ELISA Kit

Sign In for Pricing
View Details
Mouse C-type lectin domain family 18 member A (CLEC18A) ELISA Kit
MBS7246054-02 96 Well

Mouse C-type lectin domain family 18 member A (CLEC18A) ELISA Kit

Sign In for Pricing
View Details
Mouse C-type lectin domain family 18 member A (CLEC18A) ELISA Kit
MBS7246054-03 5x 96 Well

Mouse C-type lectin domain family 18 member A (CLEC18A) ELISA Kit

Sign In for Pricing
View Details