Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO39 Rabbit Polyclonal Antibody (FITC)

FBXO39 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CT144, Fbx39, FBOX39

UniProt

Q8N4B4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FBXO39

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DRSRAALVCRKWNQMMYSAELWRYRTITFSGRPSRVHASEVESAVWYVKK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_694962

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-c-Jun Antibody, Affinity Purified
A302-958A-T 2 µg

Rabbit anti-c-Jun Antibody, Affinity Purified

Sign In for Pricing
View Details
Olfr1251 Mouse shRNA Plasmid (Locus ID 259145)
TR508016 1 Kit

Olfr1251 Mouse shRNA Plasmid (Locus ID 259145)

Sign In for Pricing
View Details
PE/Cyanine7 anti-mouse CD126 (IL-6Ra chain)
GT02253 100 µg

PE/Cyanine7 anti-mouse CD126 (IL-6Ra chain)

Sign In for Pricing
View Details
TNIK CRISPRa sgRNA lentivector (set of three targets)(Mouse)
47233124 3x 1.0µg DNA

TNIK CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Recombinant Candida dubliniensis Maintenance of mitochondrial morphology protein 1 (MMM1), partial
MBS1106639-01 0.5 mg (E-Coli)

Recombinant Candida dubliniensis Maintenance of mitochondrial morphology protein 1 (MMM1), partial

Sign In for Pricing
View Details
Recombinant Candida dubliniensis Maintenance of mitochondrial morphology protein 1 (MMM1), partial
MBS1106639-02 0.05 mg (Baculovirus)

Recombinant Candida dubliniensis Maintenance of mitochondrial morphology protein 1 (MMM1), partial

Sign In for Pricing
View Details