Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO39 Rabbit Polyclonal Antibody (HRP)

FBXO39 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CT144, Fbx39, FBOX39

UniProt

Q8N4B4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FBXO39

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DRSRAALVCRKWNQMMYSAELWRYRTITFSGRPSRVHASEVESAVWYVKK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_694962

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cnot1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7271305 3x 1.0 µg

Cnot1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
CBR4 (NM_032783) Human Over-expression Lysate
LC409926 20 µg

CBR4 (NM_032783) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Ldlrad1 activation kit by CRISPRa
GA217850 1 Kit

Mouse Ldlrad1 activation kit by CRISPRa

Sign In for Pricing
View Details
PFKFB1, NT (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1, 6PF-2-K/Fru-2,6-P2ase 1, PFK/FBPase 1, 6PF-2-K/Fru-2,6-P2ase Liver Isozyme, F6PK, HL2K, MGC116715, MGC116717, PFRX) (APC)
MBS6492823-01 0.2 mL

PFKFB1, NT (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1, 6PF-2-K/Fru-2,6-P2ase 1, PFK/FBPase 1, 6PF-2-K/Fru-2,6-P2ase Liver Isozyme, F6PK, HL2K, MGC116715, MGC116717, PFRX) (APC)

Sign In for Pricing
View Details
PFKFB1, NT (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1, 6PF-2-K/Fru-2,6-P2ase 1, PFK/FBPase 1, 6PF-2-K/Fru-2,6-P2ase Liver Isozyme, F6PK, HL2K, MGC116715, MGC116717, PFRX) (APC)
MBS6492823-02 5x 0.2 mL

PFKFB1, NT (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1, 6PF-2-K/Fru-2,6-P2ase 1, PFK/FBPase 1, 6PF-2-K/Fru-2,6-P2ase Liver Isozyme, F6PK, HL2K, MGC116715, MGC116717, PFRX) (APC)

Sign In for Pricing
View Details
Anti-Zebrafish Nap1l4b Antibody, HRP Conjugate
DZ33969-1-HRP 200 µL/Vial

Anti-Zebrafish Nap1l4b Antibody, HRP Conjugate

Sign In for Pricing
View Details