Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO39 Rabbit Polyclonal Antibody (HRP)

FBXO39 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CT144, Fbx39, FBOX39

UniProt

Q8N4B4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FBXO39

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DRSRAALVCRKWNQMMYSAELWRYRTITFSGRPSRVHASEVESAVWYVKK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_694962

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLCG2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1663308 1.0 µg DNA

PLCG2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Phospho-NTRK2 (Tyr515) Antibody Blocking Peptide
orb1503531 500 µg

Phospho-NTRK2 (Tyr515) Antibody Blocking Peptide

Sign In for Pricing
View Details
Rabbit Eosinophil Associated Ribonuclease A Family Member 2 (EAR2) ELISA Kit
abx363504 96 Well

Rabbit Eosinophil Associated Ribonuclease A Family Member 2 (EAR2) ELISA Kit

Sign In for Pricing
View Details
Recombinant Fibroblast Growth Factor 9 (FGF9)
SIPA020Mu02-01 10 µg

Recombinant Fibroblast Growth Factor 9 (FGF9)

Sign In for Pricing
View Details
Recombinant Fibroblast Growth Factor 9 (FGF9)
SIPA020Mu02-02 50 µg

Recombinant Fibroblast Growth Factor 9 (FGF9)

Sign In for Pricing
View Details
Recombinant Fibroblast Growth Factor 9 (FGF9)
SIPA020Mu02-03 200 µg

Recombinant Fibroblast Growth Factor 9 (FGF9)

Sign In for Pricing
View Details