Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eid2 Rabbit Polyclonal Antibody (Biotin)

Eid2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Cr, Cri2, EID-, EID-2

UniProt

Q6X7S9

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QFLRHYLENYPIAPGRIQELEERRRRFVEACRAREAAFDIEYLRNPQRVD

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_940817

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCR8, CT (CCR8, CKRL1, CMKBR8, CMKBRL2, C-C chemokine receptor type 8, CC chemokine receptor CHEMR1, Chemokine receptor-like 1, GPR-CY6, TER1, CDw198) (MaxLight 750) discontinued
033433-ML750 100 µL

CCR8, CT (CCR8, CKRL1, CMKBR8, CMKBRL2, C-C chemokine receptor type 8, CC chemokine receptor CHEMR1, Chemokine receptor-like 1, GPR-CY6, TER1, CDw198) (MaxLight 750) discontinued

Sign In for Pricing
View Details
pExpress-1-Cyld Plasmid
PVT42690 2 µg

pExpress-1-Cyld Plasmid

Sign In for Pricing
View Details
KRT7 Protein Vector (Rat) (pPB-N-His)
PV276859 500 ng

KRT7 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Human CXCL16 ELISA Kit (DIY Antibody Pairs)
orb1098240 5 Plate

Human CXCL16 ELISA Kit (DIY Antibody Pairs)

Sign In for Pricing
View Details
CCS (Copper Chaperone for Superoxide Dismutase, Superoxide Dismutase Copper Chaperone) (MaxLight 650)
MBS6445477-01 0.1 mL

CCS (Copper Chaperone for Superoxide Dismutase, Superoxide Dismutase Copper Chaperone) (MaxLight 650)

Sign In for Pricing
View Details
CCS (Copper Chaperone for Superoxide Dismutase, Superoxide Dismutase Copper Chaperone) (MaxLight 650)
MBS6445477-02 5x 0.1 mL

CCS (Copper Chaperone for Superoxide Dismutase, Superoxide Dismutase Copper Chaperone) (MaxLight 650)

Sign In for Pricing
View Details