Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eid2 Rabbit Polyclonal Antibody (Biotin)

Eid2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Cr, Cri2, EID-, EID-2

UniProt

Q6X7S9

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QFLRHYLENYPIAPGRIQELEERRRRFVEACRAREAAFDIEYLRNPQRVD

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_940817

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Catalase (CAT) Mouse Monoclonal Antibody [Clone ID: OTI3C3]
TA502497S 30 µL

Catalase (CAT) Mouse Monoclonal Antibody [Clone ID: OTI3C3]

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O1:K1/APEC UPP Polyclonal Antibody
MBS7167001 Inquire

Rabbit anti-Escherichia coli O1:K1/APEC UPP Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Lumican Rabbit Monoclonal Antibody
MA3555-.05 50 µL

Anti-Lumican Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Traf7 Mouse shRNA Plasmid (Locus ID 224619)
TR506662 1 Kit

Traf7 Mouse shRNA Plasmid (Locus ID 224619)

Sign In for Pricing
View Details
MEIS3 Antibody - middle region : HRP (ARP47649_P050-HRP)
ARP47649_P050-HRP 100 µL

MEIS3 Antibody - middle region : HRP (ARP47649_P050-HRP)

Sign In for Pricing
View Details
SLCO1B7 (Putative Solute Carrier Organic Anion Transporter Family Member 1B7, Solute Carrier Organic Anion Transporter Family, Member 1B7 (Non-Functional) )
492219 100 µL

SLCO1B7 (Putative Solute Carrier Organic Anion Transporter Family Member 1B7, Solute Carrier Organic Anion Transporter Family, Member 1B7 (Non-Functional) )

Sign In for Pricing
View Details