Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eid2 Rabbit Polyclonal Antibody (FITC)

Eid2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Cr, Cri2, EID-, EID-2

UniProt

Q6X7S9

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QFLRHYLENYPIAPGRIQELEERRRRFVEACRAREAAFDIEYLRNPQRVD

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_940817

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNM1L sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0619208 1.0 µg DNA

DNM1L sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
N myc interactor (NMI) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A8]
TA809986AM 100 µL

N myc interactor (NMI) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A8]

Sign In for Pricing
View Details
UGT1A3 Protein Vector (Rat) (pPM-C-HA)
49114026 500 ng

UGT1A3 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Myosin Ig CRISPR/Cas9 KO Plasmid (h)
sc-408270 20 µg

Myosin Ig CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Interleukin 27A (IL27A) Magnetic Fluorescence Assay Kit
MBS2155385-01 96 Tests

Interleukin 27A (IL27A) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Interleukin 27A (IL27A) Magnetic Fluorescence Assay Kit
MBS2155385-02 5x 96 Tests

Interleukin 27A (IL27A) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details