Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENPP6 Rabbit Polyclonal Antibody (HRP)

ENPP6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NPP6

UniProt

Q6UWR7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ENPP6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ELMDMRGIFLAFGPDFKSNFRAAPIRSVDVYNVMCNVVGITPLPNNGSWS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_699174

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC85C CRISPRa sgRNA lentivector (set of three targets)(Human)
15319121 3x 1.0µg DNA

CCDC85C CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Brain Natriuretic Peptide (BNP)
MBS2043643-01 0.1 mL

HRP-Linked Polyclonal Antibody to Brain Natriuretic Peptide (BNP)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Brain Natriuretic Peptide (BNP)
MBS2043643-02 0.2 mL

HRP-Linked Polyclonal Antibody to Brain Natriuretic Peptide (BNP)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Brain Natriuretic Peptide (BNP)
MBS2043643-03 0.5 mL

HRP-Linked Polyclonal Antibody to Brain Natriuretic Peptide (BNP)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Brain Natriuretic Peptide (BNP)
MBS2043643-04 1 mL

HRP-Linked Polyclonal Antibody to Brain Natriuretic Peptide (BNP)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Brain Natriuretic Peptide (BNP)
MBS2043643-05 5 mL

HRP-Linked Polyclonal Antibody to Brain Natriuretic Peptide (BNP)

Sign In for Pricing
View Details